Structure of PDB 7qtp Chain A Binding Site BS01

Receptor Information
>7qtp Chain A (length=88) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IEEEELTLTILGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAARAGVR
VGDKLLEVNGVALQGAEHHEAVEALRGATAVQMRVWRE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qtp Structural Basis of the Avian Influenza NS1 Protein Interactions with the Cell Polarity Regulator Scribble.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		L738 I740 S741 I742 S761 R762 H793 L800
Binding residue
(residue number reindexed from 1)		L13 I15 S16 I17 S36 R37 H68 L75
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7qtp, PDBe:7qtp, PDBj:7qtp
PDBsum7qtp
PubMed35336989
UniProtQ14160|SCRIB_HUMAN Protein scribble homolog (Gene Name=SCRIB)

[Back to BioLiP]