Structure of PDB 7qs6 Chain A Binding Site BS01

Receptor Information
>7qs6 Chain A (length=118) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRP
GGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTGNA
YLQQVDSNIKGDKITYLV
Ligand information
>7qs6 Chain B (length=16) Species: 29025 (Podisus maculiventris) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VPITYCNRPTKKCPRY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qs6 Peptidomimetic antibiotics disrupt the lipopolysaccharide transport bridge of drug-resistant Enterobacteriaceae.
ResolutionN/A
Binding residue
(original residue number in PDB)		I36 I38 E39 S40 D41 Q43 L45 V52 F54 R76 L116
Binding residue
(residue number reindexed from 1)		I9 I11 E12 S13 D14 Q16 L18 V25 F27 R49 L89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001530 lipopolysaccharide binding
Biological Process
GO:0015920 lipopolysaccharide transport
Cellular Component
GO:0042597 periplasmic space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qs6, PDBe:7qs6, PDBj:7qs6
PDBsum7qs6
PubMed37224246
UniProtP0ADV1|LPTA_ECOLI Lipopolysaccharide export system protein LptA (Gene Name=lptA)

[Back to BioLiP]