Structure of PDB 7qr4 Chain A Binding Site BS01

Receptor Information
>7qr4 Chain A (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAF
VIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM
Ligand information
>7qr4 Chain B (length=69) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggggccacagcagaagcguucacgucgcagccccugucagccauugcac
uccggcugcgaauucugcu
((((((...<<<<<<<<<<.......>>>.))))))..<<<<<.......
...>>>>>....>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qr4 Anticodon-like loop-mediated dimerization in the crystal structures of HdV-like CPEB3 ribozymes
Resolution2.83 Å
Binding residue
(original residue number in PDB)
Y7 N9 N10 E13 S42 L43 K44 M45 R46 G47 Q48 F50 K74 Q79 Y80 A81 K82 S85 D86
Binding residue
(residue number reindexed from 1)
Y7 N9 N10 E13 S42 L43 K44 M45 R46 G47 Q48 F50 K74 Q79 Y80 A81 K82 S85 D86
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:7qr4, PDBe:7qr4, PDBj:7qr4
PDBsum7qr4
PubMed
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]