Structure of PDB 7qpj Chain A Binding Site BS01

Receptor Information
>7qpj Chain A (length=200) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KEVEQNSGPLSVPEGAIASLNCTYSDRGSSSFFWYRQYSGKSPELIMSIY
ANGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVRGTGRRALTF
GSGTRLQVQPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDS
DVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qpj Structural insights into engineering a T-cell receptor targeting MAGE-A10 with higher affinity and specificity for cancer immunotherapy.
Resolution1.54 Å
Binding residue
(original residue number in PDB)		R93 T95 G96 R98
Binding residue
(residue number reindexed from 1)		R91 T93 G94 R96
External links