Structure of PDB 7qi1 Chain A Binding Site BS01

Receptor Information
>7qi1 Chain A (length=234) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MGSMTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLS
VAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICN
DVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNS
QQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTA
FDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWT
Ligand information
>7qi1 Chain F (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ILPRISVISTGRRRQSVLNLMT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qi1 Macrocycle-stabilization of its interaction with 14-3-3 increases plasma membrane localization and activity of CFTR.
Resolution1.76 Å
Binding residue
(original residue number in PDB)		N44 K51 R58 R129 Y130 L174 N175 Y181 E182 T207 E211 S212 Y213 N226 W230
Binding residue
(residue number reindexed from 1)		N47 K54 R61 R132 Y133 L177 N178 Y184 E185 T210 E214 S215 Y216 N229 W233
Enzymatic activity
Enzyme Commision number ?
External links