Structure of PDB 7qdw Chain A Binding Site BS01

Receptor Information
>7qdw Chain A (length=72) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHMDYDMLTEEQKKKLKEDHTLKILLKNNYVREVFKQFTLSNDKIGYLS
HYINDPTIVQVIDHIMKTIDDT
Ligand information
>7qdw Chain B (length=25) Species: 36329 (Plasmodium falciparum 3D7) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DIYTYEKKLIKSIEYITKNKFFDDS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qdw Structural Analysis of the Plasmodial Proteins ZNHIT3 and NUFIP1 Provides Insights into the Selectivity of a Conserved Interaction.
ResolutionN/A
Binding residue
(original residue number in PDB)		Y266 D267 L269 K274 L277 K278 L287 K288 R293 F296 F299 T300 L309 M326 I329
Binding residue
(residue number reindexed from 1)		Y6 D7 L9 K14 L17 K18 L27 K28 R33 F36 F39 T40 L49 M66 I69
Enzymatic activity
Enzyme Commision number ?
External links