Structure of PDB 7q5v Chain A Binding Site BS01

Receptor Information
>7q5v Chain A (length=223) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGK
FTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCN
GKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDW
DAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRY
AITVWYFDADERARAKVKYLTGE
Ligand information
>7q5v Chain B (length=20) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ELDLETLAPYIPMDGEDFQL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7q5v Structural basis for binding of the renal carcinoma target hypoxia-inducible factor 2 alpha to prolyl hydroxylase domain 2.
Resolution1.17 Å
Binding residue
(original residue number in PDB)		Q239 L240 V241 S242 I251 R252 W258 D277 R281 N293 G294 R295 Y310 H313 V314 D315 P317 N318 R322 R370 W389 F391 R396 K400 Y403
Binding residue
(residue number reindexed from 1)		Q55 L56 V57 S58 I67 R68 W74 D93 R97 N109 G110 R111 Y126 H129 V130 D131 P133 N134 R138 R186 W205 F207 R212 K216 Y219
Enzymatic activity
Enzyme Commision number 1.14.11.29: hypoxia-inducible factor-proline dioxygenase.
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0031418 L-ascorbic acid binding

View graph for
Molecular Function
External links
PDB RCSB:7q5v, PDBe:7q5v, PDBj:7q5v
PDBsum7q5v
PubMed37449559
UniProtQ9GZT9|EGLN1_HUMAN Egl nine homolog 1 (Gene Name=EGLN1)

[Back to BioLiP]