Structure of PDB 7q4p Chain A Binding Site BS01

Receptor Information
>7q4p Chain A (length=254) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SAREWMRICFELLELLKAHKKAIRRATVNTFGYIAKAIGPHDVLATLLNN
LKVQERQNRVCTTVAIAIVAETCSPFTVLPALMNEYRVPELNVQNGVLKS
LSFLFEYIGEMGKDYIYAVTPLLEDALMDRDLVHRQTASAVVQHMSLGVY
GFGCEDSLNHLLNYVWPNVFETSPHVIQAVMGALEGLRVAIGPCRMLQYC
LQGLFHPARKVRDVYWKIYNSIYIGSQDALIAHYPRIYNDDKNTYIRYEL
DYIL
Ligand information
>7q4p Chain 2 (length=45) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucggccgcuaagauuaguaucuguucuuaucaguuuaauaucuga
..<<<.<<<<....>>>>....>>>....<<<<........>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7q4p Structural basis of branch site recognition by the human spliceosome.
Resolution2.15 Å
Binding residue
(original residue number in PDB)		H1069 K1071 R1074 R1075 R1106 R1109 C1111 V1114 N1142 K1149 F1153 V1183 Q1186 P1224 H1225 P1257 A1258 R1259
Binding residue
(residue number reindexed from 1)		H19 K21 R24 R25 R56 R59 C61 V64 N92 K99 F103 V133 Q136 P174 H175 P207 A208 R209
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
GO:1990935 splicing factor binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000375 RNA splicing, via transesterification reactions
GO:0000398 mRNA splicing, via spliceosome
GO:0006338 chromatin remodeling
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0045943 positive regulation of transcription by RNA polymerase I
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0045945 positive regulation of transcription by RNA polymerase III
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005686 U2 snRNP
GO:0005689 U12-type spliceosomal complex
GO:0005730 nucleolus
GO:0016607 nuclear speck
GO:0034693 U11/U12 snRNP
GO:0071004 U2-type prespliceosome
GO:0071005 U2-type precatalytic spliceosome
GO:0071013 catalytic step 2 spliceosome
GO:0110016 B-WICH complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7q4p, PDBe:7q4p, PDBj:7q4p
PDBsum7q4p
PubMed34822310
UniProtO75533|SF3B1_HUMAN Splicing factor 3B subunit 1 (Gene Name=SF3B1)

[Back to BioLiP]