Structure of PDB 7q4l Chain A Binding Site BS01

Receptor Information
>7q4l Chain A (length=227) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAMERVNPENKAALEAWVRETGIRLVQVNGQRKYGGPPPGWVGSPPPAGS
EVFIGRLPQDVYEHQLIPLFQRVGRLYEFRLMMTFSGLNRGFAYARYSSR
RGAQAAIATLHNHPLRPSCPLLVCRSTEKCELSVDGLPPNLTRSALLLAL
QPLGPGLQEARLLPSPGPAPGQIALLKFSSHRAAAMAKKALVEGQSHLCG
EQVAVEWLKPDLKQRLRQQLVGPFLRS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7q4l The solution structure of Dead End bound to AU-rich RNA reveals an unusual mode of tandem RRM-RNA recognition required for mRNA regulation.
ResolutionN/A
Binding residue
(original residue number in PDB)		N37 Q39 F61 R64 R88 M90 M91 T92 F93 S94 F100 Y102 H119 L130 C132 T135 K137 H189 K196 K197 W215
Binding residue
(residue number reindexed from 1)		N29 Q31 F53 R56 R80 M82 M83 T84 F85 S86 F92 Y94 H111 L122 C124 T127 K129 H181 K188 K189 W207
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:7q4l, PDBe:7q4l, PDBj:7q4l
PDBsum7q4l
PubMed36202814
UniProtQ8IYX4|DND1_HUMAN Dead end protein homolog 1 (Gene Name=DND1)

[Back to BioLiP]