Structure of PDB 7q33 Chain A Binding Site BS01

Receptor Information
>7q33 Chain A (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAGPMRLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGF
ITFSDSECAKKALEQLNGFELAGRPMKVGHVTERTDALELVPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7q33 Molecular basis of RNA-binding and autoregulation by the cancer-associated splicing factor RBM39.
ResolutionN/A
Binding residue
(original residue number in PDB)		Y253 S256 L257 H258 F259 N260 M282 R289 S290 Y293 F295 R319 K322 H325 V326 T327 R329
Binding residue
(residue number reindexed from 1)		Y8 S11 L12 H13 F14 N15 M37 R44 S45 Y48 F50 R74 K77 H80 V81 T82 R84
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Biological Process
GO:0006397 mRNA processing
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7q33, PDBe:7q33, PDBj:7q33
PDBsum7q33
PubMed37666821
UniProtQ14498|RBM39_HUMAN RNA-binding protein 39 (Gene Name=RBM39)

[Back to BioLiP]