Structure of PDB 7q2x Chain A Binding Site BS01

Receptor Information
>7q2x Chain A (length=431) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKVEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLG
IASMSTVRASSLQDLIYKRGQAGVTKASVTIVFDNTDKSNSPIGFTNSPQ
ISVTRQVVLGGTSKYLINGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKI
TKVLNMKPSEILSLIEEAAGTKMFEDRREKAERTMSKKETKLQENRTLLT
EEIEPKLEKLRNEKRMFLEFQSTQTDLESKQLNEKFQELRKKVNPNIMNM
IENVEKKEAALKTMIKTIEKDKMKIQETISKLNEYKRETLVKTWEKVTLD
FGNIFADLLPNSFAKLVPCEGKDVTQGLEVKVKLGNIWKESLIELSGGQR
SLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQF
IVVSLKEGMFANANRVFRTRFQDGTSVVSIM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7q2x Clamping of DNA shuts the condensin neck gate.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		L62 T112 S113 Q124 Q125
Binding residue
(residue number reindexed from 1)		L62 T112 S113 Q124 Q125
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000217 DNA secondary structure binding
GO:0003680 minor groove of adenine-thymine-rich DNA binding
GO:0003682 chromatin binding
GO:0003690 double-stranded DNA binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016887 ATP hydrolysis activity
Biological Process
GO:0000070 mitotic sister chromatid segregation
GO:0007059 chromosome segregation
GO:0007076 mitotic chromosome condensation
GO:0030261 chromosome condensation
GO:0051276 chromosome organization
GO:0051301 cell division
GO:0070058 tRNA gene clustering
GO:0070550 rDNA chromatin condensation
GO:1903342 negative regulation of meiotic DNA double-strand break formation
Cellular Component
GO:0000785 chromatin
GO:0000793 condensed chromosome
GO:0000796 condensin complex
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0005739 mitochondrion

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7q2x, PDBe:7q2x, PDBj:7q2x
PDBsum7q2x
PubMed35349345
UniProtP38989|SMC2_YEAST Structural maintenance of chromosomes protein 2 (Gene Name=SMC2)

[Back to BioLiP]