Structure of PDB 7pvt Chain A Binding Site BS01

Receptor Information
>7pvt Chain A (length=53) Species: 270623 (Rous sarcoma virus (strain Schmidt-Ruppin E)) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TTFVALYDYESWIETDLSFKKGERLQIVGNWWLAHSVTTGRTGYIPSNYV
APS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7pvt Crystal structure of the v-Src SH3 domain Q128R mutant in complex with the synthetic peptide VSL12
Resolution1.6 Å
Binding residue
(original residue number in PDB)		Y90 D99 N117 W118 Y131 P133 N135 Y136
Binding residue
(residue number reindexed from 1)		Y7 D16 N30 W31 Y44 P46 N48 Y49
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
Gene Ontology
Biological Process
GO:0006897 endocytosis
GO:0051666 actin cortical patch localization

View graph for
Biological Process
External links
PDB RCSB:7pvt, PDBe:7pvt, PDBj:7pvt
PDBsum7pvt
PubMed
UniProtP63185|SRC_RSVSE Tyrosine-protein kinase transforming protein Src (Gene Name=V-SRC)

[Back to BioLiP]