Structure of PDB 7po6 Chain A Binding Site BS01

Receptor Information
>7po6 Chain A (length=163) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TSKLKYVLQDARFFLIKSNNHENVSLAKAKGVWSTLPVNEKKLNLAFRSA
RSVILIFSVRESGKFQGFARLSSESHHGGSPIHWVLPAGMSAKMLGGVFK
IDWICRRELPFTKSAHLTNPWNEHKPVKIGRDGQEIELECGTQLCLLFPP
DESIDLYQVIHKM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7po6 Structural effects of m6A modification of the Xist A-repeat AUCG tetraloop and its recognition by YTHDC1.
Resolution1.77 Å
Binding residue
(original residue number in PDB)		K361 S362 N363 N367 W377 S378 R404 E405 W428 M434 I473 G474 R475 D476
Binding residue
(residue number reindexed from 1)		K17 S18 N19 N23 W33 S34 R60 E61 W84 M90 I129 G130 R131 D132
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:7po6, PDBe:7po6, PDBj:7po6
PDBsum7po6
PubMed35166835
UniProtQ96MU7|YTDC1_HUMAN YTH domain-containing protein 1 (Gene Name=YTHDC1)

[Back to BioLiP]