Structure of PDB 7pll Chain A Binding Site BS01

Receptor Information
>7pll Chain A (length=57) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GITAIALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPA
NYVELRQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7pll A novel Pyk2-derived peptide inhibits invadopodia-mediated breast cancer metastasis.
ResolutionN/A
Binding residue
(original residue number in PDB)
Y24 Y26 E33 W52 L63 N67 Y68
Binding residue
(residue number reindexed from 1)
Y8 Y10 E17 W36 L47 N51 Y52
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7pll, PDBe:7pll, PDBj:7pll
PDBsum7pll
PubMed36258022
UniProtQ60598|SRC8_MOUSE Src substrate cortactin (Gene Name=Cttn)

[Back to BioLiP]