Structure of PDB 7pdq Chain A Binding Site BS01

Receptor Information
>7pdq Chain A (length=208) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DMPVEKILEAELADPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVI
LLRAGWNELLIASFSHESIAVKDGILLATGLHVHRNSAHSAGVGAIFDRV
LTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYAS
LEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKQLEHLFFFKLIGDTPIDT
FLMEMLEA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7pdq Design and in vitro characterization of RXR variants as tools to investigate the biological role of endogenous rexinoids.
Resolution1.58 Å
Binding residue
(original residue number in PDB)
F282 V285 K289 V303 R307 T454 E458
Binding residue
(residue number reindexed from 1)
F28 V31 K35 V49 R53 T200 E204
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003707 nuclear steroid receptor activity
GO:0008270 zinc ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7pdq, PDBe:7pdq, PDBj:7pdq
PDBsum7pdq
PubMed35900852
UniProtP28700|RXRA_MOUSE Retinoic acid receptor RXR-alpha (Gene Name=Rxra)

[Back to BioLiP]