Structure of PDB 7p9w Chain A Binding Site BS01

Receptor Information
>7p9w Chain A (length=154) Species: 10377 (Human herpesvirus 4 strain B95-8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYH
VLLEEIIERNSETFTETWNRFITHTEHVDLDFNSVFLEIFHRPSLGRALA
WMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTL
IEDN
Ligand information
>7p9w Chain B (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EQWAREIGAQLRRMADDLNAQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7p9w Crystal Structures of Epstein-Barr Virus Bcl-2 Homolog BHRF1 Bound to Bid and Puma BH3 Motif Peptides.
Resolution2.0001 Å
Binding residue
(original residue number in PDB)		I57 N61 F65 R71 F72 D82 E89 I90 H92 S97 G99 R100 A103 W107
Binding residue
(residue number reindexed from 1)		I56 N60 F64 R70 F71 D81 E88 I89 H91 S94 G96 R97 A100 W104
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:7p9w, PDBe:7p9w, PDBj:7p9w
PDBsum7p9w
PubMed36298777
UniProtP03182|EAR_EBVB9 Apoptosis regulator BHRF1 (Gene Name=BHRF1)

[Back to BioLiP]