Structure of PDB 7p0s Chain A Binding Site BS01

Receptor Information
>7p0s Chain A (length=137) Species: 10258 (Orf virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DDIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGEEVRSPLLQE
LSNAGEHRANPENSHIPAALVSALLEPTSPGRMVTAVELCAQMGRLWTRG
RQLVDFMRLVYVLLDRLPPTADEDLGAWLQAVARVHG
Ligand information
>7p0s Chain U (length=24) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QWAREIGAQLRRMADDLNAQYERR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7p0s Structural Investigation of Orf Virus Bcl-2 Homolog ORFV125 Interactions with BH3-Motifs from BH3-Only Proteins Puma and Hrk.
Resolution2.50316 Å
Binding residue
(original residue number in PDB)		E46 P50 L51 H61 R62 S84 G86 R87 T90 W133 A136 V137 R139 V140
Binding residue
(residue number reindexed from 1)		E42 P46 L47 H57 R58 S79 G81 R82 T85 W128 A131 V132 R134 V135
Enzymatic activity
Enzyme Commision number ?
External links