Structure of PDB 7p0a Chain A Binding Site BS01

Receptor Information
>7p0a Chain A (length=252) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAP
WMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSG
CDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQS
GAAEHYKAYLEGECVEWLHRYLKNGTDSPKAHVTHHPRVTLRCWALGFYP
ADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVCRVYHEGLPEPLT
LR
Ligand information
>7p0a Chain C (length=9) Species: 11624 (Lymphocytic choriomeningitis virus (strain Armstrong)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KAPYNFATM
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7p0a l- to d-Amino Acid Substitution in the Immunodominant LCMV-Derived Epitope gp33 Highlights the Sensitivity of the TCR Recognition Mechanism for the MHC/Peptide Structure and Dynamics.
Resolution2.429 Å
Binding residue
(original residue number in PDB)		Y7 Y59 R62 E63 K66 Q70 W73 S77 N80 Y84 L95 Q97 F116 Y123 W147 H155 Y156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 Y59 R62 E63 K66 Q70 W73 S77 N80 Y84 L95 Q97 F116 Y123 W147 H155 Y156 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7p0a, PDBe:7p0a, PDBj:7p0a
PDBsum7p0a
PubMed35350306
UniProtP01899|HA11_MOUSE H-2 class I histocompatibility antigen, D-B alpha chain (Gene Name=H2-D1)

[Back to BioLiP]