Structure of PDB 7p09 Chain A Binding Site BS01

Receptor Information
>7p09 Chain A (length=534) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EKDDKDAIEEKFRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEFNVTR
NYLDWLTSIPWGKYSNENLDLARAQAVLEEDHYGMEDVKKRILEFIAVSQ
LRGSTQGKILCFYGPPGVGKTSIARSIARALNREYFRFSVGGMTDVAEIK
GHRRTYVGAMPGKIIQCLKKTKTENPLILIDEVDKIGRGYQGDPSSALLE
LLDPEQNANFLDHYLDVPVDLSKVLFICTANVTDTIPEPLRDRMEMINVS
GYVAQEKLAIAERYLVPQARALCGLDESKAKLSSDVLTLLIKQYCRESGV
RNLQKQVEKVLRKSAYKIVSGEAESVEVTPENLQDFVGKPVFTVERMYDV
TPPGVVMGLAWTAMGGSTLFVETSLRRPGDKDGSLEVTGQLGEVMKESAR
IAYTFARAFLMQHAPANDYLVTSHIHLHVPEGATPKDGPSAGCTIVTALL
SLAMGRPVRQNLAMTGEVSLTGKILPVGGIKEKTIAAKRAGVTCIVLPAE
NKKDFYDLAAFITEGLEVHFVEHYREIFDIAFPD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7p09 A dual allosteric pathway drives human mitochondrial Lon
Resolution2.7 Å
Binding residue
(original residue number in PDB)		V566 Y599
Binding residue
(residue number reindexed from 1)		V157 Y190
Enzymatic activity
Enzyme Commision number 3.4.21.53: endopeptidase La.
Gene Ontology
Molecular Function
GO:0001018 mitochondrial promoter sequence-specific DNA binding
GO:0003677 DNA binding
GO:0003697 single-stranded DNA binding
GO:0003727 single-stranded RNA binding
GO:0004176 ATP-dependent peptidase activity
GO:0004252 serine-type endopeptidase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008236 serine-type peptidase activity
GO:0016887 ATP hydrolysis activity
GO:0042731 PH domain binding
GO:0042802 identical protein binding
GO:0043531 ADP binding
GO:0043560 insulin receptor substrate binding
GO:0043565 sequence-specific DNA binding
GO:0051880 G-quadruplex DNA binding
GO:0070182 DNA polymerase binding
Biological Process
GO:0000002 mitochondrial genome maintenance
GO:0001666 response to hypoxia
GO:0006508 proteolysis
GO:0006515 protein quality control for misfolded or incompletely synthesized proteins
GO:0007005 mitochondrion organization
GO:0030163 protein catabolic process
GO:0032042 mitochondrial DNA metabolic process
GO:0034599 cellular response to oxidative stress
GO:0035694 mitochondrial protein catabolic process
GO:0046627 negative regulation of insulin receptor signaling pathway
GO:0051131 chaperone-mediated protein complex assembly
GO:0051603 proteolysis involved in protein catabolic process
GO:0070407 oxidation-dependent protein catabolic process
Cellular Component
GO:0005654 nucleoplasm
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix
GO:0005829 cytosol
GO:0016020 membrane
GO:0042645 mitochondrial nucleoid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7p09, PDBe:7p09, PDBj:7p09
PDBsum7p09
PubMed
UniProtP36776|LONM_HUMAN Lon protease homolog, mitochondrial (Gene Name=LONP1)

[Back to BioLiP]