BioLiP

Receptor Information

>7ozs Chain A (length=275) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AFHKLVYSRFQTKFKRRRQGKTDYYARKRLITQAKNKYNAPKYRLVVRFT
NRDIITQMVTSEINGDKIFAAAYSHELRAYGINHGLTNWAAAYATGLLLA
RRVLAKLGLEAAETERRPFKAILDVGLARTSTGARVFGVMKGASDGGIFI
PHSENRFPGYDIETEELDTEVLKKYIYGGHVAEYMETLADDDEERYKSQF
VKYIEDDVEADSLEELYAEAHKQIRADPFRKYVSDAPKKSKEEWKAESLK
YKKAKLSREERKARVEAKIKQLLAE

>7ozs Chain 3 (length=119) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

acguacgaccauacccaguggaaagcacggcaucccguccgcucugcccu
aguuaagccacugagggcccgguuaguaguugggucggugacgaccagcg
aaucccggguguuguacgu

<<<<<<<<<....<<<<<<<<.....<<<<<..............>>>..
.>>....>>>>>>.>><<<<<<......<<<.<<<<<....>>>>>>>>.
....>>>>>>>>>>>>>>>

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7ozs Structure of nascent 5S RNPs at the crossroad between ribosome assembly and MDM2-p53 pathways.
Resolution	3.5 Å
Binding residue (original residue number in PDB)	S14 F16 T18 F20 K21 R22 R24 T28 Y30 R33 R54 T56 N57 R58 D59 I61 Q63 N70 G71 D72 K73 I74 H90 G91 N94 R155 A160 R161 Y201 H206 Y210 R221 F226 K228 Y229 D261 K267 W270 K271 S274 L275 Y277 K281 L282 R284
Binding residue (residue number reindexed from 1)	S8 F10 T12 F14 K15 R16 R18 T22 Y24 R27 R48 T50 N51 R52 D53 I55 Q57 N64 G65 D66 K67 I68 H84 G85 N88 R129 A134 R135 Y175 H180 Y184 R195 F200 K202 Y203 D235 K241 W244 K245 S248 L249 Y251 K255 L256 R258

Enzyme Commision number

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008097	5S rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

PDB	RCSB:7ozs, PDBe:7ozs, PDBj:7ozs
PDBsum	7ozs
PubMed	37291423
UniProt	G0SEG2

[Back to BioLiP]

Structure of PDB 7ozs Chain A Binding Site BS01