Structure of PDB 7oye Chain A Binding Site BS01

Receptor Information
>7oye Chain A (length=209) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNIFRLTGDLSHLAAIIILLLKIWKSRSCAGISGKSQLLFALVFTTRYLD
LFTSFISLYNTSMKLIYIACSYATVYLIYMKFKATYDGNHDTFRVEFLIV
PVGGLSFLVNHDFSPLEILWTFSIYLESVAILPQLFMISKTGEAETITTH
YLFFLGLYRALYLVNWIWRYYFEGFFDLIAVVAGVVQTVLYCDFFYLYVT
KVLKGKKLS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7oye Crystal structure of the KDEL receptor bound to HDEL peptide at pH 7.0
Resolution2.62 Å
Binding residue
(original residue number in PDB)		R5 D9 Y48 M63 E117 W120 N165 W166 R169
Binding residue
(residue number reindexed from 1)		R5 D9 Y48 M63 E117 W120 N165 W166 R169
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005046 KDEL sequence binding
GO:0046923 ER retention sequence binding
Biological Process
GO:0006621 protein retention in ER lumen
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
GO:0015031 protein transport
GO:0016192 vesicle-mediated transport
GO:0035437 maintenance of protein localization in endoplasmic reticulum
Cellular Component
GO:0000139 Golgi membrane
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005794 Golgi apparatus
GO:0005801 cis-Golgi network
GO:0016020 membrane
GO:0030663 COPI-coated vesicle membrane
GO:0031410 cytoplasmic vesicle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7oye, PDBe:7oye, PDBj:7oye
PDBsum7oye
PubMed38626766
UniProtQ5ZKX9|ERD22_CHICK ER lumen protein-retaining receptor 2 (Gene Name=KDELR2)

[Back to BioLiP]