Structure of PDB 7oxk Chain A Binding Site BS01

Receptor Information
>7oxk Chain A (length=150) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEG
EAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNP
MPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHP
Ligand information
>7oxk Chain B (length=14) Species: 83333 (Escherichia coli K-12) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RYKNAKMLPFAFGA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7oxk Impact of distant peptide substrate residues on enzymatic activity of SlyD.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		Y13 D23 L27 N35 L36 I37 Y63 Y92 P102 L103 H119
Binding residue
(residue number reindexed from 1)		Y13 D23 L27 N35 L36 I37 Y63 Y92 P102 L103 H119
Enzymatic activity
Enzyme Commision number 5.2.1.8: peptidylprolyl isomerase.
Gene Ontology
Molecular Function
GO:0003755 peptidyl-prolyl cis-trans isomerase activity
GO:0046872 metal ion binding
Biological Process
GO:0042026 protein refolding

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7oxk, PDBe:7oxk, PDBj:7oxk
PDBsum7oxk
PubMed35184231
UniProtQ5SLE7

[Back to BioLiP]