Structure of PDB 7oxj Chain A Binding Site BS01

Receptor Information

>7oxj Chain A (length=156) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEG
EAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNP
MPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHP
SGHHHH

Ligand information

>7oxj Chain D (length=7) Species: 83333 (Escherichia coli K-12) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

AKALPFA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7oxj Impact of distant peptide substrate residues on enzymatic activity of SlyD.
Resolution	1.85 Å
Binding residue (original residue number in PDB)	Y13 D23 N35 L36 Y63 H119 H153 H156
Binding residue (residue number reindexed from 1)	Y13 D23 N35 L36 Y63 H119 H153 H156

Enzymatic activity

Enzyme Commision number

5.2.1.8: peptidylprolyl isomerase.

Gene Ontology

	Molecular Function
GO:0003755	peptidyl-prolyl cis-trans isomerase activity
GO:0046872	metal ion binding

	Biological Process
GO:0042026	protein refolding

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:7oxj, PDBe:7oxj, PDBj:7oxj
PDBsum	7oxj
PubMed	35184231
UniProt	Q5SLE7

[Back to BioLiP]