Structure of PDB 7oxh Chain A Binding Site BS01

Receptor Information

>7oxh Chain A (length=155) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEG
EAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNP
MPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHP
SGHHH

Ligand information

>7oxh Chain B (length=11) Species: 83333 (Escherichia coli K-12) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

NAKMLPFAFGA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7oxh Impact of distant peptide substrate residues on enzymatic activity of SlyD.
Resolution	1.7 Å
Binding residue (original residue number in PDB)	L27 N35 L36 I37 A62 Y63 Q90 P102 N118 H119 P120 H153
Binding residue (residue number reindexed from 1)	L27 N35 L36 I37 A62 Y63 Q90 P102 N118 H119 P120 H153

Enzymatic activity

Enzyme Commision number

5.2.1.8: peptidylprolyl isomerase.

Gene Ontology

	Molecular Function
GO:0003755	peptidyl-prolyl cis-trans isomerase activity
GO:0046872	metal ion binding

	Biological Process
GO:0042026	protein refolding

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:7oxh, PDBe:7oxh, PDBj:7oxh
PDBsum	7oxh
PubMed	35184231
UniProt	Q5SLE7

[Back to BioLiP]