Structure of PDB 7oxg Chain A Binding Site BS01

Receptor Information
>7oxg Chain A (length=99) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEG
EAFQAHVPAEKAYGAPGIIPPHATLDFQVEVVKVREATPEELLHGHAHP
Ligand information
>7oxg Chain C (length=14) Species: 83333 (Escherichia coli K-12) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TRYWNAKALPFAFG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7oxg Impact of distant peptide substrate residues on enzymatic activity of SlyD.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		Y13 D23 L27 S28 N35 L36 I37 Y63
Binding residue
(residue number reindexed from 1)		Y13 D23 L27 S28 N35 L36 I37 Y63
Enzymatic activity
Enzyme Commision number 5.2.1.8: peptidylprolyl isomerase.
Gene Ontology
Molecular Function
GO:0003755 peptidyl-prolyl cis-trans isomerase activity

View graph for
Molecular Function
External links
PDB RCSB:7oxg, PDBe:7oxg, PDBj:7oxg
PDBsum7oxg
PubMed35184231
UniProtQ5SLE7

[Back to BioLiP]