Structure of PDB 7oun Chain A Binding Site BS01

Receptor Information
>7oun Chain A (length=117) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQF
VHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMIS
YGGADYKRITVKVNAPY
Ligand information
>7oun Chain B (length=14) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AFLFVIRDRVFRCG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7oun Structural Characterization of a Macrocyclic Peptide Modulator of the PD-1/PD-L1 Immune Checkpoint Axis.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		Y56 E58 Q66 V76 R113 M115 A121 D122 Y123
Binding residue
(residue number reindexed from 1)		Y39 E41 Q49 V59 R96 M98 A104 D105 Y106
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7oun, PDBe:7oun, PDBj:7oun
PDBsum7oun
PubMed34443436
UniProtQ9NZQ7|PD1L1_HUMAN Programmed cell death 1 ligand 1 (Gene Name=CD274)

[Back to BioLiP]