Structure of PDB 7ouh Chain A Binding Site BS01

Receptor Information

>7ouh Chain A (length=258) Species: 33747 (Simian T-lymphotropic virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SPAKLHSFTHCGQAALTLHGATTTEALNILHSCHACRIRRGLLPNHIWQG
DITHFKYKNTLYRLHVWVDTFSGSVSATHKKRETSSEAISSLLHAIAHLG
RPSHINTDNGPAYASQEFQHACTSLAIRHTTHIPVERTNGILKTLLYKYF
SDNPNLPMDNALSVALWTINHLNVLTHCQKTRWQLHHSPRLPPIPEEKPV
TTSKTHWYYFKIPGLNSRQWKGPQRALQEAAGAALIPVSDTAAQWIPWKL
LKRAVCPR

Ligand information

>7ouh Chain I (length=21) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

actgtgtttggcgcttctctc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7ouh Structural basis for the inhibition of HTLV-1 integration inferred from cryo-EM deltaretroviral intasome structures.
Resolution	3.5 Å
Binding residue (original residue number in PDB)	N238 Q241
Binding residue (residue number reindexed from 1)	N216 Q219

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0008270	zinc ion binding

	Biological Process
GO:0015074	DNA integration

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:7ouh, PDBe:7ouh, PDBj:7ouh
PDBsum	7ouh
PubMed	34404793
UniProt	Q4QY51

[Back to BioLiP]