Structure of PDB 7oq8 Chain A Binding Site BS01

Receptor Information
>7oq8 Chain A (length=228) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLS
VAYKNVVGGQRAAWRVLSSIEQKSNGPEVREYREKVETELQGVCDTVLGL
LDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDKKRIIDSARSAYQE
AMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMA
DLHTLSEDSYKDSTLIMQLLRDNLTLWT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7oq8 A crystallography-based study of fragment extensions into the 14-3-3 binding groove
Resolution1.43 Å
Binding residue
(original residue number in PDB)		K49 R56 K122 R129 Y130 L174 N175 V178 L222 N226
Binding residue
(residue number reindexed from 1)		K54 R61 K120 R127 Y128 L171 N172 V175 L219 N223
External links