Structure of PDB 7oot Chain A Binding Site BS01

Receptor Information
>7oot Chain A (length=111) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAALF
KAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDP
YKVYRIVPEGA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7oot X-ray Structure of Interferon Regulatory Factor 4 DNA binding domain bound to interferon-stimulated response element
Resolution2.25 Å
Binding residue
(original residue number in PDB)		W54 H56 A57 P91 K94 R98 N102 K103
Binding residue
(residue number reindexed from 1)		W33 H35 A36 P70 K73 R77 N81 K82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7oot, PDBe:7oot, PDBj:7oot
PDBsum7oot
PubMed
UniProtQ15306|IRF4_HUMAN Interferon regulatory factor 4 (Gene Name=IRF4)

[Back to BioLiP]