Structure of PDB 7oj9 Chain A Binding Site BS01

Receptor Information
>7oj9 Chain A (length=67) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHMATKARVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKG
ERGLVPTDYVEILPSDG
Ligand information
>7oj9 Chain B (length=23) Species: 11021 (Eastern equine encephalitis virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AERLIPRRPAPPVPVPARIPSPR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7oj9 Structure of SNX9 SH3 in complex with a viral ligand reveals the molecular basis of its unique specificity for alanine-containing class I SH3 motifs.
ResolutionN/A
Binding residue
(original residue number in PDB)		Y9 N17 N18 E19 V35 G37 G38 W39 G50 L51 Y56
Binding residue
(residue number reindexed from 1)		Y12 N20 N21 E22 V38 G40 G41 W42 G53 L54 Y59
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7oj9, PDBe:7oj9, PDBj:7oj9
PDBsum7oj9
PubMed35390274
UniProtQ9Y5X1|SNX9_HUMAN Sorting nexin-9 (Gene Name=SNX9)

[Back to BioLiP]