Structure of PDB 7ohi Chain A Binding Site BS01

Receptor Information
>7ohi Chain A (length=250) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSPGILAPLAPGSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMF
IFYGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVKPTVDGGAQVQQVVN
IECISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQ
RWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFV
GAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ohi FCHO controls AP2's initiating role in endocytosis through a PtdIns(4,5)P 2 -dependent switch.
Resolution1.41 Å
Binding residue
(original residue number in PDB)		F837 W840 I853 D881 R905 E907 N909 Y915 R916
Binding residue
(residue number reindexed from 1)		F149 W152 I165 D193 R217 E219 N221 Y227 R228
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006886 intracellular protein transport
GO:0016192 vesicle-mediated transport
Cellular Component
GO:0030117 membrane coat
GO:0030131 clathrin adaptor complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ohi, PDBe:7ohi, PDBj:7ohi
PDBsum7ohi
PubMed35486718
UniProtP17427|AP2A2_MOUSE AP-2 complex subunit alpha-2 (Gene Name=Ap2a2)

[Back to BioLiP]