Structure of PDB 7od6 Chain A Binding Site BS01

Receptor Information
>7od6 Chain A (length=143) Species: 490133 (Hepatitis B virus ayw/France/Tiollais/1979) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7od6 Conformational Plasticity of Hepatitis B Core Protein Spikes Promotes Peptide Binding Independent of the Secretion Phenotype.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		N75 L76 E77 S81
Binding residue
(residue number reindexed from 1)		N75 L76 E77 S81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0005198 structural molecule activity
Biological Process
GO:0046718 symbiont entry into host cell
GO:0075521 microtubule-dependent intracellular transport of viral material towards nucleus
GO:0075732 viral penetration into host nucleus
Cellular Component
GO:0030430 host cell cytoplasm
GO:0039619 T=4 icosahedral viral capsid
GO:0043657 host cell

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7od6, PDBe:7od6, PDBj:7od6
PDBsum7od6
PubMed33946808
UniProtP03146|CAPSD_HBVD3 Capsid protein (Gene Name=C)

[Back to BioLiP]