Structure of PDB 7o6n Chain A Binding Site BS01

Receptor Information
>7o6n Chain A (length=95) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TSSHTVLLIQTSPRLDSRTWGDYESVTDALDALCKMFEDFLSKKSAAPVT
YDVSQVYEFLDKLSDVSMMIFNRETGQYIGRTRAWIKQQVYEMMR
Ligand information
>7o6n Chain C (length=17) Species: 6239 (Caenorhabditis elegans) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FNSEDIKDSVFKVLHAE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7o6n Structural basis of PETISCO complex assembly during piRNA biogenesis in C. elegans .
Resolution2.17 Å
Binding residue
(original residue number in PDB)		L17 D18 R20
Binding residue
(residue number reindexed from 1)		L15 D16 R18
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7o6n, PDBe:7o6n, PDBj:7o6n
PDBsum7o6n
PubMed34413138
UniProtQ20057|ERH2_CAEEL Enhancer of rudimentary homolog 2 (Gene Name=erh-2)

[Back to BioLiP]