Structure of PDB 7o50 Chain A Binding Site BS01

Receptor Information

>7o50 Chain A (length=262) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIVVMMYDDIA
YSEDNPTPGIVINRPNGTDVYQGVPKDYTGEDVTPQNFLAVLRGDAEAVK
GIGSGKVLKSGPQDHVFIYFTcHGSTGILVFPNEDLHVKDLNETIHYMYK
HKMYRKMVFYIEACESGSMMNHLPDNINVYATTAANPRESSYACYYDEKR
STYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTQTSHVMQYGNKTI
STMKVMQFQGMK

Ligand information

>7o50 Chain H (length=3) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GSN

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7o50 The Peptide Ligase Activity of Human Legumain Depends on Fold Stabilization and Balanced Substrate Affinities.
Resolution	1.9 Å
Binding residue (original residue number in PDB)	R44 H45 H148 C189 S215 S216 Y217 A218 D231
Binding residue (residue number reindexed from 1)	R19 H20 H123 C164 S190 S191 Y192 A193 D206

Enzymatic activity

Enzyme Commision number

3.4.22.34: legumain.

Gene Ontology

	Molecular Function
GO:0008233	peptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:7o50, PDBe:7o50, PDBj:7o50
PDBsum	7o50
PubMed	34621593
UniProt	Q99538\|LGMN_HUMAN Legumain (Gene Name=LGMN)

[Back to BioLiP]