Structure of PDB 7o1f Chain A Binding Site BS01

Receptor Information
>7o1f Chain A (length=253) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALEARLEQASILKKVVDAIKDLVQDCNFDCNDSGIALQAMDNSHVALVSM
MLKAEGFSPYRCDRNIALGVNLTSLTKVLRAAQNEDILTLKAEPDVLNLV
FESSETDRISEYDLKLMDIDQEHLGIPETEYAATITMPSNEFKRITTDLM
AMSESVTIEANKDGVKFSCQGDIGNGSVTLRQHTNVEKPNESIEIELSEP
VSLTFSLKYLVNFCKASALSNTVKICLSNEVPLLVEYSLGGSSYLRFYLA
PKI
Ligand information
>7o1f Chain J (length=8) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KHQSTLNF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7o1f Non-canonical binding of the Chaetomium thermophilum PolD4 N-terminal PIP motif to PCNA involves Q-pocket and compact 2-fork plug interactions but no 3 10 helix.
Resolution2.45 Å
Binding residue
(original residue number in PDB)		H44 V45 L126 I128 Y250 A252 P253 K254 I255
Binding residue
(residue number reindexed from 1)		H44 V45 L124 I126 Y248 A250 P251 K252 I253
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030337 DNA polymerase processivity factor activity
Biological Process
GO:0006260 DNA replication
GO:0006272 leading strand elongation
GO:0006275 regulation of DNA replication
GO:0006281 DNA repair
GO:0006298 mismatch repair
GO:0019985 translesion synthesis
Cellular Component
GO:0005634 nucleus
GO:0043626 PCNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7o1f, PDBe:7o1f, PDBj:7o1f
PDBsum7o1f
PubMed35942639
UniProtG0SF70|PCNA_CHATD Proliferating cell nuclear antigen (Gene Name=CTHT_0061010)

[Back to BioLiP]