Structure of PDB 7nmg Chain A Binding Site BS01

Receptor Information
>7nmg Chain A (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAP
WIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFG
CDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAA
HVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7nmg Human MHC Class I, A24 Allele presenting LWM, Complex with 4C6 TCR
Resolution2.48 Å
Binding residue
(original residue number in PDB)
Y7 M45 E63 K66 H70 N77 I80 Y84 F99 H114 Y116 T143 K146 W147 Q156 Y159 T163 G167 Y171
Binding residue
(residue number reindexed from 1)
Y7 M45 E63 K66 H70 N77 I80 Y84 F99 H114 Y116 T143 K146 W147 Q156 Y159 T163 G167 Y171
Enzymatic activity
Enzyme Commision number ?
External links