Structure of PDB 7nmf Chain A Binding Site BS01

Receptor Information
>7nmf Chain A (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAP
WIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFG
CDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAA
HVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7nmf Human MHC Class I, A24 Allele presenting QLPRLFPLL, Complex with 4C6 TCR, monoclinic form
Resolution2.98 Å
Binding residue
(original residue number in PDB)		M5 Y7 E63 K66 H70 T73 N77 I80 Y84 F99 Y116 T143 W147 Y159 G167 R170 Y171
Binding residue
(residue number reindexed from 1)		M5 Y7 E63 K66 H70 T73 N77 I80 Y84 F99 Y116 T143 W147 Y159 G167 R170 Y171
Enzymatic activity
Enzyme Commision number ?
External links