Structure of PDB 7nlc Chain A Binding Site BS01

Receptor Information
>7nlc Chain A (length=144) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRE
LMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGK
HVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7nlc Crystallographic structure of human Tsg101 UEV domain in complex with a HEV ORF3 peptide
Resolution1.398 Å
Binding residue
(original residue number in PDB)		D36 Y70 N71 M97 V143 F144 S145 P147
Binding residue
(residue number reindexed from 1)		D33 Y67 N68 M94 V140 F141 S142 P144
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0015031 protein transport
GO:0036211 protein modification process

View graph for
Biological Process
External links
PDB RCSB:7nlc, PDBe:7nlc, PDBj:7nlc
PDBsum7nlc
PubMed
UniProtQ99816|TS101_HUMAN Tumor susceptibility gene 101 protein (Gene Name=TSG101)

[Back to BioLiP]