Structure of PDB 7njc Chain A Binding Site BS01

Receptor Information
>7njc Chain A (length=149) Species: 508771 (Toxoplasma gondii ME49) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PQSTKRFFIIKSNRMSNIYTSIQHGVWATSKGNSRKLSNAFTSTDHVLLL
FSANESGGFQGFGRMMSLPDPQLFPGIWGPVQLRLGSNFRVMWLKQCKIE
FEELGKVTNPWNDDLPLRKSRDGTEVPPALGSLLCTWMSQRPSEDLLAG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7njc A plant-like mechanism coupling m6A reading to polyadenylation safeguards transcriptome integrity and developmental gene partitioning in Toxoplasma .
Resolution1.38 Å
Binding residue
(original residue number in PDB)		K452 N495 E496 R559 K560 S561 R562 D563
Binding residue
(residue number reindexed from 1)		K11 N54 E55 R118 K119 S120 R121 D122
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:7njc, PDBe:7njc, PDBj:7njc
PDBsum7njc
PubMed34263725
UniProtS8F6K2

[Back to BioLiP]