Structure of PDB 7nab Chain A Binding Site BS01

Receptor Information
>7nab Chain A (length=226) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVESGAEVKKPGESLKISCKGSGYTFTRYWIGWVRQMPGKGLEWMGI
IYPGDSDTRYSPSFQGHVTISADKSISTAYLQWNSLKASDTAMYYCARLP
QYCSNGVCQRWFDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAAL
GCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSS
LGTQTYICNVNHKPSNTKVDKKVEPK
Ligand information
>7nab Chain D (length=20) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DSFKEELDKYFKNHTSPDVD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7nab Structural basis and mode of action for two broadly neutralizing antibodies against SARS-CoV-2 emerging variants of concern.
Resolution2.15 Å
Binding residue
(original residue number in PDB)		T30 R31 Y32 W33 Y52 D54 D56 Q97 Y98 C99 C100D
Binding residue
(residue number reindexed from 1)		T30 R31 Y32 W33 Y52 D55 D57 Q101 Y102 C103 C108
External links