Structure of PDB 7n6k Chain A Binding Site BS01

Receptor Information

>7n6k Chain A (length=216) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTI
HVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSA
KDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQ
GDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKM
QELAQVSQKLMEIAQQ

Ligand information

>7n6k Chain B (length=6) Species: 83333 (Escherichia coli K-12) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ALALLP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7n6k Selective promiscuity in the binding of E. coli Hsp70 to an unfolded protein.
Resolution	2.55 Å
Binding residue (original residue number in PDB)	T403 F426 S427 A429 Q433 V436 T437
Binding residue (residue number reindexed from 1)	T15 F38 S39 A41 Q45 V48 T49

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005524	ATP binding
GO:0140662	ATP-dependent protein folding chaperone

View graph for
Molecular Function

External links

PDB	RCSB:7n6k, PDBe:7n6k, PDBj:7n6k
PDBsum	7n6k
PubMed	34625496
UniProt	P0A6Y8\|DNAK_ECOLI Chaperone protein DnaK (Gene Name=dnaK)

[Back to BioLiP]