Structure of PDB 7n5w Chain A Binding Site BS01

Receptor Information
>7n5w Chain A (length=85) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LGSAFQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFTRQDKLK
VHMRKHTGEKPYLCQQCGAAFAHNYDLKNHMRVHT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7n5w Structural basis for transcription factor ZBTB7A recognition of DNA and effects of ZBTB7A somatic mutations that occur in human acute myeloid leukemia.
Resolution2.24 Å
Binding residue
(original residue number in PDB)		K389 Q392 K396 R399 H400 R421 K424
Binding residue
(residue number reindexed from 1)		K13 Q16 K20 R23 H24 R45 K48
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7n5w, PDBe:7n5w, PDBj:7n5w
PDBsum7n5w
PubMed36626981
UniProtO95365|ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A (Gene Name=ZBTB7A)

[Back to BioLiP]