Structure of PDB 7n5s Chain A Binding Site BS01

Receptor Information
>7n5s Chain A (length=111) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFTRQDKLKVHMR
KHTGEKPYLCQQCGAAFAHNYDLKNHMRVHTGLRPYQCDSCCKTFVRSDH
LHRHLKKDGCN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7n5s Structural basis for human ZBTB7A action at the fetal globin promoter.
Resolution2.86 Å
Binding residue
(original residue number in PDB)
K389 I391 Q392 K396 R399 H400 T403 R421 R458 R464 R477 R483
Binding residue
(residue number reindexed from 1)
K9 I11 Q12 K16 R19 H20 T23 R41 R78 R84 R97 R103
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7n5s, PDBe:7n5s, PDBj:7n5s
PDBsum7n5s
PubMed34592153
UniProtO95365|ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A (Gene Name=ZBTB7A)

[Back to BioLiP]