Structure of PDB 7n10 Chain A Binding Site BS01

Receptor Information
>7n10 Chain A (length=60) Species: 198466 (Streptococcus pyogenes MGAS315) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVER
VEEVMVELDK
Ligand information
>7n10 Chain C (length=5) Species: 198466 (Streptococcus pyogenes MGAS315) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HHHHH
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7n10 Molecular mechanism of quorum sensing inhibition in Streptococcus by the phage protein paratox.
Resolution1.65 Å
Binding residue
(original residue number in PDB)
D12 K13 G14 Y15
Binding residue
(residue number reindexed from 1)
D12 K13 G14 Y15
Enzymatic activity
Enzyme Commision number ?
External links