Structure of PDB 7mx2 Chain A Binding Site BS01

Receptor Information
>7mx2 Chain A (length=152) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RTIRYVRYESELQMPDIMRLITKDLSEPYSIYTYRYFIHNWPQLCFLAMV
GEECVGAIVCKLDMHKKMFRRGYIAMLAVDSKYRRNGIGTNLVKKAIYAM
VEGDCDEVVLETEITNKSALKLYENLGFVRDKRLFRYYLNGVDALRLKLW
LR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7mx2 Molecular role of NAA38 in thermostability and catalytic activity of the human NatC N-terminal acetyltransferase.
Resolution3.64 Å
Binding residue
(original residue number in PDB)		L235 Y239 Y283 Y347 Y348
Binding residue
(residue number reindexed from 1)		L25 Y29 Y73 Y137 Y138
Enzymatic activity
Enzyme Commision number 2.3.1.256: N-terminal methionine N(alpha)-acetyltransferase NatC.
Gene Ontology
Molecular Function
GO:0004596 peptide alpha-N-acetyltransferase activity
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups
Biological Process
GO:0017196 N-terminal peptidyl-methionine acetylation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7mx2, PDBe:7mx2, PDBj:7mx2
PDBsum7mx2
PubMed36638802
UniProtQ147X3|NAA30_HUMAN N-alpha-acetyltransferase 30 (Gene Name=NAA30)

[Back to BioLiP]