Structure of PDB 7mcs Chain A Binding Site BS01

Receptor Information

>7mcs Chain A (length=249) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

TRIQAVYRDTGVEAYRDNPFIEALPPLQTHLLLSERISVMIRGGYVGRNP
KTGDLQKHLQNGYERVQTGELETFRFEEARSTAQSLLLIGCSGSGKTTSL
HRILATYPQVIYHRELNVEQVVYLKIDCSHNGSLKEICLNFFRALDRALG
SNYERRYGLKRHGIETMLALMSQIANAHVLGLLVIDEIQHLSRSRSGGSQ
EMLNFFVTMVNIIGVPVMLIGTPKAREIFEADLRSARRGAGFGAIFWDP

Ligand information

>7mcs Chain I (length=15) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gcgcgcgcgcgcgcg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7mcs Structural basis for DNA targeting by the Tn7 transposon.
Resolution	3.56 Å
Binding residue (original residue number in PDB)	K206 R207
Binding residue (residue number reindexed from 1)	K160 R161

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005524	ATP binding
GO:0016887	ATP hydrolysis activity

	Biological Process
GO:0006310	DNA recombination
GO:0032196	transposition

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:7mcs, PDBe:7mcs, PDBj:7mcs
PDBsum	7mcs
PubMed	35173349
UniProt	P05846\|TNSC_ECOLX Transposon Tn7 transposition protein TnsC (Gene Name=tnsC)

[Back to BioLiP]