Structure of PDB 7m8u Chain A Binding Site BS01

Receptor Information
>7m8u Chain A (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAP
WIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYG
CDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
RVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
>7m8u Chain C (length=9) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IPFAMQMAY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7m8u SARS-CoV-2 Spike-Derived Peptides Presented by HLA Molecules
Resolution1.45 Å
Binding residue
(original residue number in PDB)		Y7 R62 N63 I66 F67 T69 N70 T73 Y74 E76 S77 Y84 R97 Y99 S116 T143 K146 W147 A150 V152 Q155 L156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 R62 N63 I66 F67 T69 N70 T73 Y74 E76 S77 Y84 R97 Y99 S116 T143 K146 W147 A150 V152 Q155 L156 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links