Structure of PDB 7m6t Chain A Binding Site BS01

Receptor Information

>7m6t Chain A (length=154) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDY
LLTISVKTSAGPTNLRIEYQDGKFRLDSIICVALAAFDSVVHLIDYYVQM
CKDKHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEY
KFQV

Ligand information

>7m6t Chain D (length=11) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

LQHLMDKWMAM

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7m6t Discovery of an exosite on the SOCS2-SH2 domain that enhances SH2 binding to phosphorylated ligands.
Resolution	3.194 Å
Binding residue (original residue number in PDB)	A33 L36 D74 D79 L81 Y99
Binding residue (residue number reindexed from 1)	A3 L6 D44 D49 L51 Y69

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0035556	intracellular signal transduction

View graph for
Biological Process

External links

PDB	RCSB:7m6t, PDBe:7m6t, PDBj:7m6t
PDBsum	7m6t
PubMed	34857742
UniProt	O14508\|SOCS2_HUMAN Suppressor of cytokine signaling 2 (Gene Name=SOCS2)

[Back to BioLiP]