Structure of PDB 7m5w Chain A Binding Site BS01

Receptor Information
>7m5w Chain A (length=138) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DHIRRPMNAFMIFSKRHRALVHQRHPNQDNRTVSKILGEWWYALGPKEKQ
KYHDLAFQVKEAHFKAHPDWKWCNPYSSLRRTLDQRRALVMQLFQDHGFF
PSAQATAAFQARYADIFPSKVCLQLKIREVRQKIMQAA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7m5w Molecular basis of DNA recognition by the HMG-box-C1 module of Capicua
Resolution2.95 Å
Binding residue
(original residue number in PDB)
R35 R36 M38 M42 K46 R49 D60 N61 R62 L126 R130 K169
Binding residue
(residue number reindexed from 1)
R4 R5 M7 M11 K15 R18 D29 N30 R31 L83 R87 K126
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7m5w, PDBe:7m5w, PDBj:7m5w
PDBsum7m5w
PubMed
UniProtQ96RK0|CIC_HUMAN Protein capicua homolog (Gene Name=CIC)

[Back to BioLiP]