Structure of PDB 7m10 Chain A Binding Site BS01

Receptor Information
>7m10 Chain A (length=68) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TVPVYCVCRLPYDVTRFMIECDACKDWFHGSCVGVEEEEAPDIDIYHCPN
CEKTHGKSTLKKKRTWHK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7m10 Histone H3 N-terminal mimicry drives a novel network of methyl-effector interactions.
Resolution1.15 Å
Binding residue
(original residue number in PDB)		Y7 Y14 V16 T17 F19 M20 I21 E22 W29 E39 Y48
Binding residue
(residue number reindexed from 1)		Y5 Y12 V14 T15 F17 M18 I19 E20 W27 E37 Y46
Enzymatic activity
Enzyme Commision number 1.14.11.-
Gene Ontology
Cellular Component
GO:0048188 Set1C/COMPASS complex

View graph for
Cellular Component
External links
PDB RCSB:7m10, PDBe:7m10, PDBj:7m10
PDBsum7m10
PubMed33969871
UniProtO75151|PHF2_HUMAN Lysine-specific demethylase PHF2 (Gene Name=PHF2)

[Back to BioLiP]